en · de · pt
reference-notes.peptides8425.com › Topic › Background And Peptide Identity — Hands-On Walkthrough

Background And Peptide Identity — Hands-On Walkthrough

By Editorial Desk · published 2026-04-05 · last reviewed 2026-05-04 · Topic

Everything below concerns nootropic. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.

Updated 2026-05-04. Numbers and descriptions here follow the published literature rather than marketing material.

Background and Peptide Identity

Selank is a synthetic heptapeptide developed in Russia. Its sequence is Thr-Lys-Pro-Arg-Pro-Gly-Pro, a seven-residue chain built around the natural tetrapeptide tuftsin. Researchers at the Institute of Molecular Genetics of the Russian Academy of Sciences first described the compound in the mid-1990s. The design combined the tuftsin core with an added Pro-Gly-Pro tail, a modification intended to extend the molecule's stability in biological fluids. Published work on the peptide has appeared mainly in Russian-language journals.

Reported activity for Selank centers on anxiolytic and nootropic effects. Russian clinical reports describe use in anxiety and in cognitive or attention-related complaints. Most of this evidence comes from studies conducted by the same research groups that developed the peptide. Independent replication in other countries remains limited, and no major Western regulatory agency has approved the compound for any indication. The gap between local reports and external verification is a recurring point in discussions of the peptide.

Tuftsin, the parent structure, is a naturally occurring immunomodulatory tetrapeptide released from the Fc region of immunoglobulin G by spleen enzymes. Selank extends this four-residue sequence with three additional amino acids. The stated rationale is that the added tail slows enzymatic breakdown and may influence receptor interactions. How the full heptapeptide behaves at the molecular level is not firmly established, and proposed mechanisms often involve indirect modulation of neurotransmitter or immune signaling rather than a single defined target.

Selank Origin and Chemical Identity

The compound has a calculated molecular weight near 751.9 daltons and carries a net positive charge at physiological pH because of its arginine residue. It dissolves freely in water and in common aqueous buffers, and typically appears as a white or off-white lyophilized powder. The amide backbone makes the molecule susceptible to peptidases, which limits oral use and favors intranasal or parenteral routes. Nomenclature in the literature varies: the substance is also described by the sequence abbreviation TP-7 and by a Russian trade designation.

Regulatory status differs sharply by region. Selank holds a Russian marketing authorization, where it is supplied mainly as nasal drops, while authorities elsewhere have not approved it for medical use. Material sold internationally is therefore usually labeled as a research chemical rather than a medicine. Peer-reviewed publications come predominantly from Russian laboratories, and sample sizes are generally small. Whether the compound produces comparable effects under independent, well-controlled replication remains an open question that the broader literature has not settled.

Selank is a synthetic heptapeptide developed in Russia as a structural analogue of tuftsin, a naturally occurring immunomodulatory tetrapeptide. Its sequence, Thr-Lys-Pro-Arg-Pro-Gly-Pro, keeps the tuftsin core at the N-terminus and appends a Pro-Gly-Pro tail. Researchers at the Institute of Molecular Genetics in Moscow synthesized the compound during the 1990s while searching for peptides with combined anxiolytic and immunomodulatory activity. The added tail was intended to resist enzymatic cleavage and prolong the molecule's presence in circulation.

Selank at a glance

PropertyValueNotes
Chemical classSynthetic heptapeptideModeled on tuftsin
Amino acid sequenceThr-Lys-Pro-Arg-Pro-Gly-ProSeven residues
Approximate molecular massAround 750 DaDepends on counter-ion and hydration
Common formsLyophilized powderAlso described as aqueous solution
Primary origin of researchRussian laboratoriesMid-1990s onward

Origins and Proposed Mechanisms

Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences as a structural analogue of tuftsin, a naturally occurring tetrapeptide fragment of the immunoglobulin heavy chain. The added Pro-Gly-Pro tail was intended to slow enzymatic degradation and extend biological activity. In Russia it is registered as an anxiolytic nasal preparation, while regulators elsewhere have not approved it for clinical use.

Proposed mechanisms centre on modulation of the GABAergic system, with reports of altered expression of genes related to GABA-A receptor subunits and changed monoamine turnover. Some studies describe inhibition of enkephalinase, the enzyme that degrades endogenous enkephalins, which may prolong opioid peptide signalling. Effects on brain-derived neurotrophic factor and on cytokine expression have also been reported. These findings come largely from animal models and small human studies, and the precise primary target remains unresolved.

Published clinical evidence is limited. Most controlled trials were conducted in Russia, enrolled modest numbers of participants, and appeared in Russian-language journals, which restricts independent verification. Reported outcomes include lower anxiety scores, improved attention and memory measures, and changes in fatigue ratings. Reviews written in English note methodological limitations such as small samples and inconsistent endpoints. Whether the compound produces clinically meaningful benefit relative to established anxiolytics is therefore an open question rather than an established finding.

Related pages on this site

Peptide Identity and Structure

The compound was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences during the 1980s and 1990s. The stated design goal was to retain the immunomodulatory and central nervous system activity attributed to tuftsin while improving resistance to enzymatic breakdown. Adding a proline-rich tail to the short parent peptide was a deliberate strategy, because proline residues restrict the conformations available to many peptidases. The same laboratory produced Semax, an ACTH fragment analog, and both compounds were developed in parallel as short, enzymatically stabilized peptides intended for intranasal use.

Selank is not a naturally occurring peptide and has no known endogenous counterpart in human physiology. Russian-language sources frequently call it TP-7, while English-language sources use the name Selank almost exclusively. Database indexing is uneven, partly because early reports appeared in regional journals that are not widely cataloged. Some summaries describe the material as a tuftsin analog and others as a synthetic heptapeptide; the labels overlap rather than conflict. Citing the primary sequence resolves ambiguity more reliably than the research or trade name alone.

Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, written TKPRPGP in one-letter notation. Its structure consists of the immunomodulatory tetrapeptide tuftsin, Thr-Lys-Pro-Arg, extended at the carboxyl terminus by a Pro-Gly-Pro segment. The molecular formula is commonly given as C33H57N11O9, corresponding to a monoisotopic mass near 751.4 Da and an average molecular mass near 751.9 Da. All seven residues are proteinogenic amino acids, and the molecule carries no modified side chains or non-natural linkages.

Supporting material

T-box, brain, 1 is a transcription factor protein important in vertebrate embryo development. It is encoded by the TBR1 gene. This gene is also known by several other names: T-Brain 1, TBR-1, TES-56, and MGC141978. TBR1 is a member of the TBR1 subfamily of T-box family transcription factors, which share a common DNA-binding domain. Other members of the TBR1 subfamily include EOMES and TBX21. TBR1 is involved in the differentiation and migration of neurons and is required for normal brain development. TBR1 interacts with various genes and proteins in order to regulate cortical development, specifically within layer VI of the developing six-layered human cortex. Studies show that TBR1 may play a role in major neurological diseases such as Alzheimer's disease (AD), Parkinson's disease (PD) and autism spectrum disorder (ASD).

After earning his doctorate in biochemistry, Lehninger held various faculty positions at the University of Wisconsin–Madison and the University of Chicago. In 1952, he went to the Johns Hopkins School of Medicine, assuming the title of DeLamar Professor of the Department of Biological Chemistry. He served in this position until 1978, when he was appointed to the role of University Professor of Medical Sciences. He held this title until his death in 1986. 1948 – Paul-Lewis Award in Enzyme Chemistry 1951 – Guggenheim Fellowship 1956 – Elected to the National Academy of Sciences 1959 – Elected to the American Academy of Arts and Sciences 1969 – Remsen Award of the American Chemical Society 1970 – American Philosophical Society 1986 – Passano Foundation Award Forthcoming in New Dictionary of Scientific Biography

In the phosphatidylinositol signal pathway, the extracellular signal molecule binds with the G-protein receptor (Gq) on the cell surface and activates phospholipase C, which is located on the plasma membrane. The lipase hydrolyzes PIP2 into two second messengers: inositol 1,4,5-trisphosphate (IP3) and diacylglycerol (DAG). IP3 binds with the IP3 receptor in the membrane of the smooth endoplasmic reticulum and mitochondria to open Ca2+ channels. DAG helps activate protein kinase C (PKC), which phosphorylates many other proteins, changing their catalytic activities, leading to cellular responses. The effects of Ca2+ are also remarkable: it cooperates with DAG in activating PKC and can activate the CaM kinase pathway, in which calcium-modulated protein calmodulin (CaM) binds Ca2+, undergoes a change in conformation, and activates CaM kinase II, which has unique ability to increase its binding affinity to CaM by autophosphorylation, making CaM unavailable for the activation of other enzymes. The kinase then phosphorylates target enzymes, regulating their activities. The two signal pathways are connected together by Ca2+-CaM, which is also a regulatory subunit of adenylyl cyclase and phosphodiesterase in the cAMP signal pathway.

Benninghoven graduated from the University of Cologne in 1961 where he worked with Fritz Kirchner (1896–1967) and completed his habilitation in surface physics in Cologne two years later. He first worked as professor in Cologne from 1965 to 1973 until he moved to a full professor position in experimental physics at the University of Münster in 1972. He worked on static secondary ion mass spectrometry (SIMS) and its applications, and developed SIMS instruments. In 1989 he co-founded IonTOF, a company that became a world-leader in TOF-SIMS instrumentation. He has written over 300 scientific articles and several books on the topic of SIMS, many of which have become reference works on SIMS. For his work, he has received the Technology Transfer prize (German Ministry of Education and Research) and the 1984 Gaede-Langmuir Prize (American Vacuum Society) for the development of concepts and instrumentation in static secondary ion mass spectrometry and the demonstration of its usefulness in manifold applications. In 1990 he shared the Fritz-Pregl-Medaille of the Austrian Society of Analytical Chemistry with Wilhelm Simon. From 1977 to 1983, he was president of the German Vacuum Society (part of the German Physical Society).

Sources: en.wikipedia.org

Supporting material

The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.

Ectopic fat is the storage of triglycerides in tissues other than adipose tissue, that are supposed to contain only small amounts of fat, such as the liver, skeletal muscle, heart, and pancreas. This can interfere with cellular functions and hence organ function and is associated with insulin resistance in type 2 diabetes. It is stored in relatively high amounts around the organs of the abdominal cavity, but is not to be confused with visceral fat. The specific cause for the accumulation of ectopic fat is unknown. The cause is likely a combination of genetic, environmental, and behavioral factors that are involved in excess energy intake and decreased physical activity. Substantial weight loss can reduce ectopic fat stores in all organs and this is associated with an improvement of the function of those organs. In the latter case, non-invasive weight loss interventions like diet or exercise can decrease ectopic fat (particularly in heart and liver) in overweight or obese children and adults.

ISOLDE contains both temporary and fixed experimental setups. Temporary setups in the ISOLDE facility are there for shorter time periods, and generally focus on detecting specific decay modes of nuclei. The fixed experimental setups have a permanent position at the facility. They include: The COLinear LAser SPectroScopy (COLLAPS) experiment has been operating at ISOLDE since the late 1970s and is the oldest active experiment at the facility. COLLAPS studies ground and isomeric state properties of highly-unstable (exotic), short-lived nuclei, including measurements of their spins, electro-magnetic moments and charge radii. The experiment uses the technique of collinear spectroscopy using lasers to access necessary atomic transitions. The Collinear Resonance Ionization Spectroscopy (CRIS) experiment uses fast beam collinear laser spectroscopy alongside the technique of resonance ionization to produce results with a high resolution and efficiency. The experiment studies group-state properties of exotic nuclei and produces isomeric beams used for decay studies.

Sources: en.wikipedia.org

Supporting material

Camurus' FluidCrystal are available as injectable depots and topical bioadhesive delivery technologies. By encapsulating the drug compound in the nanostructures, injectable depots are able to deliver therapeutic levels of drug substance over extended periods from a single injection. This leads to a decrease in traditional side effects associated with high initial drug release on injection (drug burst), poor drug stability, and complex processing requirements, making the system highly suitable for sustained parental delivery of peptides, proteins, and small molecule drug compounds. The topical delivery system creates a bio-adhesive film that provides local and continual release of drug compounds. The delivery system is suited for delivery of peptide, protein, and small molecule drug compounds and can be applied to dermal, buccal, ophthalmic, nasal, vaginal, and other topical surfaces.

It is a cyclin dependent kinase containing the catalytic subunit, Cdk9, and a regulatory subunit, cyclin T in Drosophila. In humans there are multiple forms of P-TEFb which contain Cdk9 and one of several cyclin subunits, cyclin T1, T2, and K. P-TEFb associates with other factors including the bromodomain protein BRD4, and is found associated with a large complex of proteins called the super elongation complex. Importantly, for the AIDS virus, HIV, P-TEFb is targeted by the HIV Tat protein which bypasses normal cellular P-TEFb control and directly brings P-TEFb to the promoter proximal paused polymerase in the HIV genome.

The US Food and Drug Administration has issued warning letters to firms including colloidal silver marketers for selling products with false and misleading claims to prevent, treat, mitigate, diagnose or cure coronavirus disease 2019 (COVID-19). In 2020, televangelist felon Jim Bakker was sued by the Missouri Attorney General (AG) for marketing colloidal silver products and making false claims about their effectiveness against COVID-19. The Attorney General of New York sent a cease and desist order to Bakker and others about peddling the unproven products that were compared to selling "snake oil", and the Food and Drug Administration also warned Bakker about his actions. Controversial web show host, podcaster and conspiracy theorist Alex Jones was also warned by the New York Attorney General's office to stop marketing his colloidal silver infused products (toothpaste, mouthwash, dietary supplements, etc.) because he made unproven claims of its ability to fend off COVID-19.

Evolutionary biology is a subfield of biology that analyzes the mechanisms of evolution. Evolution accounts for the unity and diversity of life on Earth; Theodosius Dobzhansky famously said "nothing in biology makes sense except in the light of evolution". Population genetics for example studies how genetic variation develops, how it is inherited, and how the evolutionary mechanisms shape a population's genetic composition. Research in evolutionary biology covers many topics and incorporates ideas from diverse areas, such as molecular genetics and mathematical and theoretical biology. Some fields of evolutionary research try to explain phenomena that were poorly accounted for in the modern evolutionary synthesis. These include speciation, the evolution of sexual reproduction, the evolution of cooperation, the evolution of ageing, and evolvability. Ecology is the study of the distribution and abundance of life, the interaction between organisms and their environment.

Sources: en.wikipedia.org

Frequently asked questions

What type of molecule is Selank?

Selank is a synthetic peptide made of seven amino acids. It is modeled on tuftsin, a natural tetrapeptide, with an added three-residue tail. It is not a small-molecule drug.

Where was Selank developed?

It originates from research in Russia, associated with the Institute of Molecular Genetics of the Russian Academy of Sciences. The first descriptions date to the mid-1990s. Most published studies come from Russian laboratories.

Is Selank found in nature?

No, Selank itself does not occur naturally. Its backbone is based on tuftsin, which is produced in the body, but the seven-residue version is a synthetic construct. It is supplied as a manufactured peptide.

What is Selank?

Selank is a synthetic seven-amino-acid peptide modeled on tuftsin, a fragment of the immunoglobulin G heavy chain. It was designed in Russia to combine anxiolytic and immunomodulatory properties in one molecule.

Network